PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G16100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 395aa    MW: 42316.7 Da    PI: 8.814
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G16100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-5391421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+v+yL+++++++++++ ++i++vdiyk++PwdLp+k++ +++ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++s
  OGLUM03G16100.1   9 LPPGFRFHPTDEELIVHYLRNRAASSPCPV-SIIADVDIYKFDPWDLPSKANYGDREWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHS 101
                      79****************************.89***************999999**************************************** PP

              NAM  95 k.......kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +       ++e vg+kk Lvfykgr pkg+kt+W+mheyrl
  OGLUM03G16100.1 102 SgggggaaTNESVGVKKALVFYKGRPPKGTKTNWIMHEYRL 142
                      988887777777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-645176IPR003441NAC domain
PROSITE profilePS5100561.2599176IPR003441NAC domain
PfamPF023652.8E-2710142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MVLSNPAMLP PGFRFHPTDE ELIVHYLRNR AASSPCPVSI IADVDIYKFD PWDLPSKANY  60
GDREWYFFSP RDRKYPNGIR PNRAAGSGYW KATGTDKPIH SSGGGGGAAT NESVGVKKAL  120
VFYKGRPPKG TKTNWIMHEY RLAAADAHAA NTYRPMKFRN TSMRLDDWVL CRIYKKSSHA  180
SPLAVPPLSD HEQDEPCALE ENAPLYAPSS SSAASMILQG AAAGAFPSLH AAAAATPRTA  240
MQKIPSISDL LNEYSLSQLF DDSGAAAAAP LQEMARQPDH HHHHQQQHAL FGHPVMNHFI  300
ANNSMVQLAH LDPSSSAAAS TSAGAVVEPP AVTGKRKRSS DGGEPTIQAL PPAAAAAKKP  360
NGSCVGATFQ IGSALQGSSL GLSHQMLLHS NMGMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-73918020172NAC domain-containing protein 19
3swp_C3e-73918020172NAC domain-containing protein 19
3swp_B3e-73918020172NAC domain-containing protein 19
3swp_A3e-73918020172NAC domain-containing protein 19
3swm_D3e-73918020172NAC domain-containing protein 19
3swm_C3e-73918020172NAC domain-containing protein 19
3swm_B3e-73918020172NAC domain-containing protein 19
3swm_A3e-73918020172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2435140.0AK243514.1 Oryza sativa Japonica Group cDNA, clone: J100075D15, full insert sequence.
GenBankJN9823130.0JN982313.1 Oryza sativa Japonica Group NAC transcription factor 58 (NAC58) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632401.10.0PREDICTED: NAC transcription factor ONAC010-like
SwissprotQ8H4S42e-87NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA0A0D9Z6P20.0A0A0D9Z6P2_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g21060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.13e-85NAC-like, activated by AP3/PI